Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-SRP54 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SRP54 antibody: synthetic peptide directed towards the middle region of human SRP54. Synthetic peptide located within the following region: ENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEA

SRP54 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human

Rabbit Polyclonal Anti-SRP54 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SRP54