Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-DDX23 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDX23 antibody: synthetic peptide directed towards the C terminal of human DDX23. Synthetic peptide located within the following region: EDSAVFYELKQAILESPVSSCPPELANHPDAQHKPGTILTKKRREETIFA

DDX23 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated