Primary Antibodies

View as table Download

Rabbit polyclonal anti-DGKQ antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DGKQ.

Rabbit Polyclonal Anti-DGKQ Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DGKQ antibody: synthetic peptide directed towards the middle region of human DGKQ. Synthetic peptide located within the following region: DAELSLDFHQAREEEPGKFTSRLHNKGVYVRVGLQKISHSRSLHKQIRLQ

DGKQ Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 683-942 of human DGKQ (NP_001338.2).
Modifications Unmodified