Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-HES5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen HES5 antibody was raised against a 19 amino acid peptide near the amino terminus of human HES5.

Rabbit Polyclonal Anti-Beclin 2 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Beclin 2 antibody was raised against a 16 amino acid peptide near the amino terminus of human Beclin 2.

Rabbit Polyclonal HES5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A portion of amino acid1-50 of human HES5 was used as the immunogen for this antibody.

Rabbit Polyclonal Anti-HES5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HES5

Rabbit Polyclonal Anti-HES5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HES5 antibody: synthetic peptide directed towards the middle region of human HES5. Synthetic peptide located within the following region: AASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAH