Primary Antibodies

View as table Download

Rabbit polyclonal anti-KCNJ4 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human KCNJ4.

Rabbit Polyclonal Anti-KCNJ4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNJ4 antibody: synthetic peptide directed towards the middle region of human KCNJ4. Synthetic peptide located within the following region: AVAAGLGLEAGSKEEAGIIRMLEFGSHLDLERMQASLPLDNISYRRESAI

KCNJ4 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human KCNJ4 (NP_004972.1).
Modifications Unmodified