Rabbit polyclonal anti-KCNJ4 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human KCNJ4. |
Rabbit polyclonal anti-KCNJ4 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human KCNJ4. |
Rabbit Polyclonal Anti-KCNJ4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNJ4 antibody: synthetic peptide directed towards the middle region of human KCNJ4. Synthetic peptide located within the following region: AVAAGLGLEAGSKEEAGIIRMLEFGSHLDLERMQASLPLDNISYRRESAI |
KCNJ4 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human KCNJ4 (NP_004972.1). |
Modifications | Unmodified |