Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-MCTS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCTS1 antibody: synthetic peptide directed towards the N terminal of human MCTS1. Synthetic peptide located within the following region: MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPV

MCTS1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human MCTS1

MCTS1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-181 of human MCTS1 (NP_054779.1).
Modifications Unmodified