Primary Antibodies

View as table Download

RBL2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human RBL2

Rabbit polyclonal anti-p130 Rb2 antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rb2 (p130) peptide corresponding to a region near the C-terminus of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH).

Rabbit polyclonal pRb2 p130 antibody

Applications WB
Reactivities Chimpanzee, Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared by repeated immunizations with a synthetic peptide corresponding to the Spa310 sequence of pRb2/p130 protein. A residue of cysteine was added to facilitate coupling.

Rabbit Polyclonal anti-RBL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RBL2 antibody is: synthetic peptide directed towards the C-terminal region of Human RBL2. Synthetic peptide located within the following region: NETMLSPREKIFYYFSNSPSKRLREINSMIRTGETPTKKRGILLEDGSES

Rabbit Polyclonal Anti-RBL2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-RBL2 antibody is: synthetic peptide directed towards the C-terminal region of Human RBL2. Synthetic peptide located within the following region: SKRLREINSMIRTGETPTKKRGILLEDGSESPAKRICPENHSALLRRLQD

RBL2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human RBL2

RBL2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human RBL2 (NP_005602.3).
Modifications Unmodified