Rabbit polyclonal anti-SLC25A25 antibody (N-term)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | This SLC25A25 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 63-93 amino acids from the N-terminal region of human SLC25A25. |
Rabbit Polyclonal Anti-SLC25A25 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC25A25 Antibody: synthetic peptide directed towards the N terminal of human SLC25A25. Synthetic peptide located within the following region: KLSVFIPSQEFSTYRQWKQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLR |
Rabbit Polyclonal Anti-SLC25A25 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC25A25 Antibody: synthetic peptide directed towards the N terminal of human SLC25A25. Synthetic peptide located within the following region: MLQMLWHFLASFFPRAGCHGSREGDDREVRGTPAPAWRDQMASFLGKQDG |
Rabbit Polyclonal Anti-SLC25A25 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC25A25 Antibody: synthetic peptide directed towards the N terminal of human SLC25A25. Synthetic peptide located within the following region: AVGLRRLGLHRTEGELQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLV |
Germany
Japan
United Kingdom
China