Primary Antibodies

Jump to Filters
View as table Download
ADH7 Rabbit Polyclonal Antibody
TA346215

USD 475.00

5 Days

Rabbit Polyclonal Anti-Adh7 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Adh7 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Adh7. Synthetic peptide located within the following region: LTYDPMLLFTGRTWKGCVFGGWKSRDDVPKLVTEFLEKKFDLDQLITHTL
ADH7 Rabbit Polyclonal Antibody
TA373301

USD 275.00

3 Weeks

ADH7 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-386 of human ADH7 (NP_000664.2).
Modifications Unmodified