Primary Antibodies

View as table Download

Rabbit polyclonal antibody to GPR4 (G protein-coupled receptor 4)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 159 and 254 of GPR4 (Uniprot ID#P46093)

GPR4 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Bat, Bovine, Human, Monkey, Mouse, Rabbit, Rat, Dog, Pig, Gibbon
Conjugation Unconjugated
Immunogen GPR4 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human GPR4. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Mouse, Rat, Dog, Bat, Bovine, Panda, Rabbit, Pig (100%); Zebrafish (85%); Pufferfish, Stickleback (80%).

GPR4 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Dog, Gorilla, Human, Monkey
Conjugation Unconjugated
Immunogen GPR4 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human GPR4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Dog, Panda (100%); Mouse, Rat, Bovine, Bat, Pig (95%); Rabbit (89%).

Rabbit Polyclonal Anti-Gpr4 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Gpr4 antibody is: synthetic peptide directed towards the middle region of Mouse Gpr4. Synthetic peptide located within the following region: LCYRGILRAVQSSVSTERQEKVKIKRLALSLIAIVLVCFAPYHALLLSRS