Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-HACE1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HACE1 antibody: synthetic peptide directed towards the middle region of human HACE1. Synthetic peptide located within the following region: DVSDWIKNTEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSRV

Rabbit Polyclonal Anti-HACE1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HACE1 antibody is: synthetic peptide directed towards the N-terminal region of Human HACE1. Synthetic peptide located within the following region: RARTVELPEDNETAVYTLMPMVMADQHRSVSELLSNSKFDVNYAFGRVKR

Rabbit Polyclonal Anti-HACE1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HACE1

HACE1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HACE1

HACE1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HACE1 (NP_065822.2).
Modifications Unmodified