Goat Polyclonal Antibody against SMUG1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence PQAFLLGSIHEPA-C, from the N Terminus of the protein sequence according to NP_055126. |
Goat Polyclonal Antibody against SMUG1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence PQAFLLGSIHEPA-C, from the N Terminus of the protein sequence according to NP_055126. |
Rabbit polyclonal anti-SMUG1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SMUG1. |
Rabbit Polyclonal Anti-SMUG1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SMUG1 antibody: synthetic peptide directed towards the middle region of human SMUG1. Synthetic peptide located within the following region: IVGPVLTPPQEHPKRPVLGLECPQSEVSGARFWGFFRNLCGQPEVFFHHC |
SMUG1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SMUG1 |
SMUG1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SMUG1 |
SMUG1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human SMUG1 (NP_055126.1). |
Modifications | Unmodified |
Rabbit polyclonal anti-SMUG1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SMUG1 |
Rabbit polyclonal anti-SMUG1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SMUG1 |