Primary Antibodies

View as table Download

Rabbit Polyclonal antibody to TAAR5 (trace amine associated receptor 5)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 273 and 337 of TAAR5 (Uniprot ID#O14804)

Rabbit Polyclonal Anti-TAAR5 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TAAR5 antibody: synthetic peptide directed towards the C terminal of human TAAR5. Synthetic peptide located within the following region: TTLSKSLAGAAKHERKAAKTLGIAVGIYLLCWLPFTIDTMVDSLLHFITP

Rabbit Polyclonal Anti-TAAR5 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TAAR5 antibody: synthetic peptide directed towards the middle region of human TAAR5. Synthetic peptide located within the following region: GWLNFPLFFVPCLIMISLYVKIFVVATRQAQQITTLSKSLAGAAKHERKA

PNR / TAAR5 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Chimpanzee, Human
Immunogen TAAR5 antibody was raised against synthetic 18 amino acid peptide from C-Terminus of human TAAR5. Percent identity with other species by BLAST analysis: Human, Chimpanzee (100%); Gorilla, Gibbon, Baboon, Monkey (94%); Orangutan (89%); Marmoset, Tamarin (83%).

PNR / TAAR5 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Chimpanzee, Gorilla, Human, Rabbit
Immunogen TAAR5 antibody was raised against synthetic 15 amino acid peptide from N-terminal extracellular domain of human TAAR5. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Baboon, Marmoset, Tamarin, Rabbit (100%); Orangutan, Monkey, Rat, Horse (93%); Mouse, Bat, Hamster, Panda, Pig (87%); Bovine, Dog, Elephant (80%).