Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-CA7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CA7 antibody: synthetic peptide directed towards the C terminal of human CA7. Synthetic peptide located within the following region: SLTTPPLSESVTWIVLREPICISERQMGKFRSLLFTSEDDERIHMVNNFR

Rabbit Polyclonal Anti-CA7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CA7 antibody is: synthetic peptide directed towards the middle region of Human CA7. Synthetic peptide located within the following region: YRLKQFHFHWGKKHDVGSEHTVDGKSFPSELHLVHWNAKKYSTFGEAASA

CA7 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein

CA7 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein

CA7 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-264 of human CA7 (NP_005173.1).
Modifications Unmodified