Primary Antibodies

Jump to Filters
View as table Download
SIAH Interacting Protein (CACYBP) Rabbit Polyclonal Antibody
TA308595

USD 415.00

5 Days

Rabbit Polyclonal antibody to CacyBP (calcyclin binding protein)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 228 of CacyBP (Uniprot ID#Q9HB71)
SIAH Interacting Protein (CACYBP) Rabbit Polyclonal Antibody
TA339163

USD 310.00

5 Days

Rabbit Polyclonal Anti-CACYBP

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACYBP antibody: synthetic peptide directed towards the middle region of human CACYBP. Synthetic peptide located within the following region: FTERSFDLLVKNLNGKSYSMIVNNLLKPISVEGSSKKVKTDTVLILCRKK
SIAH Interacting Protein (CACYBP) Rabbit Polyclonal Antibody
TA374202

USD 220.00

3 Weeks

CACYBP Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-228 of human CACYBP (NP_055227.1).
Modifications Unmodified