Primary Antibodies

Jump to Filters
View as table Download
Cytoplasmic dynein 1 light intermediate chain 1 (DYNC1LI1) Rabbit Polyclonal Antibody
TA338052

USD 375.00

5 Days

Rabbit Polyclonal Anti-DYNC1LI1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DYNC1LI1 antibody is: synthetic peptide directed towards the C-terminal region of Human DYNC1LI1. Synthetic peptide located within the following region: AEDDQVFLMKLQSLLAKQPPTAAGRPVDASPRVPGGSPRTPNRSVSSNVA
DYNC1LI1 Rabbit Polyclonal Antibody
TA370055

USD 380.00

4 Weeks

DYNC1LI1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DYNC1LI1