Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-EPN2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EPN2 Antibody: A synthesized peptide derived from human EPN2

Epsin 2 (EPN2) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat

Rabbit polyclonal anti-EPN2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EPN2.

Rabbit polyclonal Anti-EPN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPN2 antibody: synthetic peptide directed towards the middle region of human EPN2. Synthetic peptide located within the following region: SHSEQEYGKAGGSPASYHGSTSPRVSSELEQARPQTSGEEELQLQLALAM

Rabbit polyclonal Anti-EPN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPN2 antibody: synthetic peptide directed towards the middle region of human EPN2. Synthetic peptide located within the following region: DPFESQPLTVASSKPSSARKTPESFLGPNAALVNLDSLVTRPAPPAQSLN

EPN2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human EPN2

EPN2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 120-300 of human EPN2 (NP_683723.2).
Modifications Unmodified

Epn2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of mouse Epn2 (XP_006532226.1).
Modifications Unmodified