Primary Antibodies

Jump to Filters
View as table Download
NAGS Rabbit Polyclonal Antibody
TA339882

USD 310.00

5 Days

Rabbit Polyclonal Anti-NAGS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NAGS antibody: synthetic peptide directed towards the C terminal of human NAGS. Synthetic peptide located within the following region: YLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHSD
NAGS Rabbit Polyclonal Antibody
TA378915

USD 220.00

3 Weeks

NAGS Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 295-534 of human NAGS (NP_694551.1).
Modifications Unmodified