Primary Antibodies

Jump to Filters
View as table Download
NT5DC1 Rabbit Polyclonal Antibody
TA329780

USD 375.00

5 Days

Rabbit polyclonal Anti-NT5DC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NT5DC1 antibody: synthetic peptide directed towards the N terminal of human NT5DC1. Synthetic peptide located within the following region: EWKHFLSDTGMACRSGKYYFYDNYFDLPGALLCARVVDYLTKLNNGQKTF