Primary Antibodies

Jump to Filters
View as table Download
RNPEP Rabbit Polyclonal Antibody
TA344801

USD 475.00

5 Days

Rabbit Polyclonal Anti-Rnpep Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Rnpep antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rnpep. Synthetic peptide located within the following region: TCLEAATGRALLRQHMNVSGEENPLNKLRVKIEPGVDPDDTYNETPYEKG
RNPEP Rabbit Polyclonal Antibody
TA381005

USD 220.00

3 Weeks

RNPEP Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 371-650 of human RNPEP (NP_064601.3).
Modifications Unmodified