Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-SHBG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SHBG antibody is: synthetic peptide directed towards the C-terminal region of SHBG. Synthetic peptide located within the following region: RGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH |
Rabbit Polyclonal Anti-SHBG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SHBG antibody is: synthetic peptide directed towards the N-terminal region of Human SHBG. Synthetic peptide located within the following region: FDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLH |
USD 465.00
In Stock
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) SHBG mouse monoclonal antibody, clone OTI1E7 (formerly 1E7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 465.00
4 Weeks
USD 465.00
In Stock
USD 465.00
In Stock
Anti-SHBG Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 68-81 amino acids of Human sex hormone-binding globulin |
USD 379.00
In Stock
USD 159.00
2 Days
USD 379.00
In Stock
SHBG mouse monoclonal antibody, clone OTI1E7 (formerly 1E7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 159.00
2 Days
SHBG mouse monoclonal antibody, clone OTI1E7 (formerly 1E7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 379.00
In Stock
USD 159.00
2 Days
USD 379.00
In Stock
USD 159.00
2 Days
USD 379.00
In Stock
USD 159.00
2 Days
Active filters
Target Symbol
- SHBG
Conjugates
- Unconjugated
Families
- Druggable Genome