Primary Antibodies

Jump to Filters
View as table Download
SND1 Rabbit Polyclonal Antibody
TA330608

USD 310.00

5 Days

Rabbit Polyclonal Anti-SND1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SND1 antibody: synthetic peptide directed towards the N terminal of human SND1. Synthetic peptide located within the following region: LPDYYLVTVMLSGIKCPTFRREADGSETPEPFAAEAKFFTESRLLQRDVQ