Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-NPY1R Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NPY1R antibody: synthetic peptide directed towards the middle region of human NPY1R. Synthetic peptide located within the following region: TDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFI

Rabbit Polyclonal Anti-Neuropeptide Y1 Receptor

Applications IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide (C)RLKRRNNMMDKMRDNK, corresponding to amino acid residues 237-252 of human NPY1R. 3rd intracellular loop.

Rabbit polyclonal anti-NPY1R antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NPY1R.

Rabbit anti-NPY1R Polyclonal Antibody

Applications IHC, WB
Reactivities Human Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human NPY1R

Anti-NPY1R rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 370-384 amino acids of Human neuropeptide Y receptor Y1

Anti-NPY1R Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 370-384 amino acids of Human neuropeptide Y receptor Y1