Rabbit Polyclonal Vitamin D Receptor Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Vitamin D Receptor |
Rabbit Polyclonal Vitamin D Receptor Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Vitamin D Receptor |
Rabbit Polyclonal Vitamin D Receptor (Ser208) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Vitamin D Receptor around the phosphorylation site of Serine 208 |
Modifications | Phospho-specific |
Rabbit polyclonal Vitamin D3 Receptor (Phospho-Ser51) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Vitamin D3 Receptor around the phosphorylation site of serine 51 (R-R-SP-M-K). |
Modifications | Phospho-specific |
Rabbit polyclonal Vitamin D3 Receptor (Ab-51) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Vitamin D3 Receptor around the phosphorylation site of serine 51 (R-R-SP-M-K). |
Rabbit polyclonal Vitamin D Receptor (Ser208) antibody(Phospho-specific)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Vitamin D Receptor around the phosphorylation site of serine 208 (D-L-SP-E-E). |
Modifications | Phospho-specific |
Goat Polyclonal Antibody against VDR
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CGNQDYKYRVSD, from the internal region of the protein sequence according to NP_000367.1; NP_001017535.1. |
Rabbit Polyclonal anti-VDR antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-VDR antibody: synthetic peptide directed towards the N terminal of human VDR. Synthetic peptide located within the following region: LKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPV |
Rabbit Polyclonal Anti-VDR Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-VDR antibody: synthetic peptide directed towards the N terminal of human VDR. Synthetic peptide located within the following region: EAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRS |
Rabbit Polyclonal Anti-VDR Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-VDR antibody: synthetic peptide directed towards the N terminal of human VDR. Synthetic peptide located within the following region: ILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPP |