Primary Antibodies

Jump to Filters
View as table Download
C2 Rabbit Polyclonal Antibody
TA346156

USD 410.00

5 Days

Rabbit Polyclonal Anti-C2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C2 antibody: synthetic peptide directed towards the middle region of human C2. Synthetic peptide located within the following region: INQKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQ
C2 Rabbit Polyclonal Antibody
TA346155

USD 475.00

5 Days

Rabbit Polyclonal Anti-C2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C2 antibody: synthetic peptide directed towards the N terminal of human C2. Synthetic peptide located within the following region: EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS
C2 Rabbit Polyclonal Antibody
TA308854

USD 415.00

5 Days

Rabbit Polyclonal antibody to Complement C2 (complement component 2)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 265 and 642 of Complement C2 (Uniprot ID#P06681)
C2 Mouse Monoclonal Antibody [Clone ID: OTI1A7]
CF807163

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) C2 mouse monoclonal antibody,clone OTI1A7

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
C2 Mouse Monoclonal Antibody [Clone ID: OTI12G10]
CF807188

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) C2 mouse monoclonal antibody,clone OTI12G10

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
C2 Mouse Monoclonal Antibody [Clone ID: OTI1A7]
TA807163

USD 379.00

In Stock

C2 mouse monoclonal antibody,clone OTI1A7

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
C2 Mouse Monoclonal Antibody [Clone ID: OTI1A7]
TA807163S

USD 159.00

2 Days

C2 mouse monoclonal antibody,clone OTI1A7

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
C2 Mouse Monoclonal Antibody [Clone ID: OTI12G10]
TA807188

USD 379.00

In Stock

C2 mouse monoclonal antibody,clone OTI12G10

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
C2 Mouse Monoclonal Antibody [Clone ID: OTI12G10]
TA807188S

USD 159.00

In Stock

C2 mouse monoclonal antibody,clone OTI12G10

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated