Primary Antibodies

Jump to Filters
View as table Download
ACSM2A Rabbit Polyclonal Antibody
TA332273

USD 375.00

5 Days

Rabbit Polyclonal Anti-ACSM2A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACSM2A Antibody is: synthetic peptide directed towards the C-terminal region of Human ACSM2A. Synthetic peptide located within the following region: SYKFPHLQNCVTVGESLLPETLENWRAQTGLDIRESYGQTETGLTCMVSK
ACSM2A Rabbit Polyclonal Antibody
TA373216

USD 275.00

3 Weeks

ACSM2A Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 418-577 of human ACSM2A (NP_001295101.1).
Modifications Unmodified