Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-ALDH6A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH6A1 antibody: synthetic peptide directed towards the middle region of human ALDH6A1. Synthetic peptide located within the following region: GQVGVNVPIPVPLPMFSFTGSRSSFRGDTNFYGKQGIQFYTQLKTITSQW

Rabbit Polyclonal Anti-ALDH6A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH6A1 antibody: synthetic peptide directed towards the middle region of human ALDH6A1. Synthetic peptide located within the following region: AVLVGEAKKWLPELVEHAKNLRVNAGDQPGADLGPLITPQAKERVCNLID

Anti-ALDH6A1 rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human aldehyde dehydrogenase 6 family, member A1

Anti-ALDH6A1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human aldehyde dehydrogenase 6 family, member A1

ALDH6A1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 326-535 of human ALDH6A1 (NP_005580.1).
Modifications Unmodified