Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit polyclonal anti-CHST2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CHST2. |
Rabbit Polyclonal Anti-CHST2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHST2 antibody: synthetic peptide directed towards the middle region of human CHST2. Synthetic peptide located within the following region: NAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL |
CHST2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CHST2 |
CHST2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 231-530 of human CHST2 (NP_004258.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CHST2
Isotypes
- IgG
Conjugates
- Unconjugated