Rabbit Polyclonal antibody to CSE1L (CSE1 chromosome segregation 1-like (yeast))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 222 and 469 of CSE1L (Uniprot ID#P55060) |
Rabbit Polyclonal Anti-CSE1L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSE1L antibody: synthetic peptide directed towards the N terminal of human CSE1L. Synthetic peptide located within the following region: ELSDANLQTLTEYLKKTLDPDPAIRRPAEKFLESVEGNQNYPLLLLTLLE |
Exportin 2 (XPO2) Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Exportin 2 (XPO2) (NP_001243064.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
