Primary Antibodies

Jump to Filters
View as table Download
KIR2DL4 Rabbit Polyclonal Antibody
TA346319

USD 475.00

5 Days

Rabbit Polyclonal Anti-KIR2DL4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KIR2DL4 antibody: synthetic peptide directed towards the middle region of human KIR2DL4. Synthetic peptide located within the following region: VSVTGNPSSSWPSPTEPSFKTGIARHLHAVIRYSVAIILFTILPFFLLHR
KIR2DL4 Rabbit Polyclonal Antibody
TA377816

USD 220.00

3 Weeks

KIR2DL4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-242 of human KIR2DL4 (NP_002246.5).
Modifications Unmodified