Primary Antibodies

Jump to Filters
View as table Download
OXCT2 Rabbit Polyclonal Antibody
TA346817

USD 475.00

5 Days

Rabbit Polyclonal Anti-OXCT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OXCT2 antibody: synthetic peptide directed towards the middle region of human OXCT2. Synthetic peptide located within the following region: GIPLLASNFISPSMTVHLHSENGILGLGPFPTEDEVDADLINAGKQTVTV
OXCT2 Rabbit Polyclonal Antibody
TA379540

USD 220.00

3 Weeks

OXCT2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 430-510 of human OXCT2 (NP_071403.1).
Modifications Unmodified