Primary Antibodies

Jump to Filters
View as table Download
SLIT3 Rabbit Polyclonal Antibody
TA344211

USD 475.00

5 Days

Rabbit Polyclonal Anti-SLIT3 Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SLIT3 antibody: synthetic peptide directed towards the N terminal of human SLIT3. Synthetic peptide located within the following region: PRRLANKRISQIKSKKFRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIV
SLIT3 Rabbit Polyclonal Antibody
TA351721

USD 345.00

In Stock

Rabbit Polyclonal Anti-SLIT3 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLIT3
SLIT3 Rabbit Polyclonal Antibody
TA367275

USD 380.00

4 Weeks

SLIT3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLIT3