Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-BDH2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BDH2 antibody: synthetic peptide directed towards the middle region of human BDH2. Synthetic peptide located within the following region: NRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQAR

Goat Polyclonal Antibody against BDH2 / DHRS6 (aa 60 to 71)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TKKKQIDQFANE, from the internal region of the protein sequence according to NP_064524.3.

Carrier-free (BSA/glycerol-free) BDH2 mouse monoclonal antibody, clone OTI4G4 (formerly 4G4)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) BDH2 mouse monoclonal antibody, clone OTI3G10 (formerly 3G10)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) BDH2 mouse monoclonal antibody, clone OTI2G1 (formerly 2G1)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-BDH2 mouse monoclonal antibody, clone OTI4G4 (formerly 4G4)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-BDH2 mouse monoclonal antibody, clone OTI4G4 (formerly 4G4)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-BDH2 mouse monoclonal antibody, clone OTI3G10 (formerly 3G10)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-BDH2 mouse monoclonal antibody, clone OTI3G10 (formerly 3G10)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-BDH2 mouse monoclonal antibody, clone OTI2G1 (formerly 2G1)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-BDH2 mouse monoclonal antibody, clone OTI2G1 (formerly 2G1)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated