Primary Antibodies

View as table Download

Rabbit Polyclonal VISA Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen VISA antibody was raised against a 13 amino acid peptide from near the amino terminus of human VISA.

Rabbit anti-MAVS Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MAVS

Rabbit Polyclonal Anti-MAVS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAVSantibody: synthetic peptide directed towards the C terminal of human VISA. Synthetic peptide located within the following region: VAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQ

Rabbit Polyclonal VISA Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen VISA antibody was raised against a 17 amino acid peptide from near the center of human VISA.

Mouse Monoclonal MAVS Antibody (58N3B6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-MAVS Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAVSantibody: synthetic peptide directed towards the N terminal of human VISA. Synthetic peptide located within the following region: ETQAPESPGENSEQALQTLSPRAIPRNPDGGPLESSSDLAALSPLTSSGH

Mouse Monoclonal MAVS Antibody (58N3E1)

Applications WB
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal MAVS Antibody (58N2B2)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MAVS mouse monoclonal antibody, clone OTI8A11 (formerly 8A11)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MAVS mouse monoclonal antibody, clone OTI9C7 (formerly 9C7)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MAVS mouse monoclonal antibody, clone OTI9C4 (formerly 9C4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-MAVS Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human MAVS

MAVS mouse monoclonal antibody, clone OTI8A11 (formerly 8A11)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

MAVS mouse monoclonal antibody, clone OTI8A11 (formerly 8A11)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

MAVS mouse monoclonal antibody, clone OTI9C7 (formerly 9C7)

Applications WB
Reactivities Human
Conjugation Unconjugated

MAVS mouse monoclonal antibody, clone OTI9C7 (formerly 9C7)

Applications WB
Reactivities Human
Conjugation Unconjugated

MAVS mouse monoclonal antibody, clone OTI9C4 (formerly 9C4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

MAVS mouse monoclonal antibody, clone OTI9C4 (formerly 9C4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated