Primary Antibodies

View as table Download

Goat Polyclonal Antibody against Serotonin receptor 1B / HTR1B

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SNEDFKQAFHK, from the C Terminus of the protein sequence according to NP_000854.1.

Rabbit Polyclonal Anti-5-Hydroxytryptamine Receptor 1B (extracellular)

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Peptide CSAKDYIYQDSISLPWK, corresponding to amino acid residues 33-49 of human 5-Hydroxytryptamine Receptor 1B . Extracellular, N-terminus.

Rabbit Polyclonal Anti-HTR1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR1B antibody: synthetic peptide directed towards the N terminal of human HTR1B. Synthetic peptide located within the following region: MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKV

Rabbit Polyclonal 5-HT1B Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This antibody was generated by immunizing rabbits with a mixture of synthetic peptides corresponding to amino acids 8-26 and 263-278 of rat 5-HT1BR (Accession number P28564)