Primary Antibodies

View as table Download

Rabbit polyclonal anti-HTR4 antibody

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human HTR4.

Rabbit polyclonal anti-5-HT-4 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human 5-HT-4.

Rabbit Polyclonal 5HT4 Receptor Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to an C-terminal portion of the human 5HT4 Receptor protein (between residues 350-400) [UniProt Q13639]

Rabbit Polyclonal Anti-HTR4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR4 antibody: synthetic peptide directed towards the middle region of human HTR4. Synthetic peptide located within the following region: GCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYA

Rabbit Polyclonal Anti-HTR4 Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen HTR4 / 5-HT4 Receptor antibody was raised against synthetic 15 amino acid peptide from 3rd cytoplasmic domain of human 5HT4 Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Dog, Bat, Bovine, Rabbit, Horse, Pig (100%); Mouse, Rat, Hamster (93%); Guinea pig, Platypus (87%); Lizard (80%).

Rabbit Polyclonal Anti-HTR4 Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen HTR4 / 5-HT4 Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human 5HT4 Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Mouse, Rat (94%); Marmoset, Hamster, Elephant, Panda, Dog, Horse, Pig, Guinea pig (88%); Bat, Rabbit (81%).

Anti-5HT4 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 45-59 amino acids of Human 5-hydroxytryptamine (serotonin) receptor 4, G protein-coupled