Rabbit anti-MIF Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MIF |
Rabbit anti-MIF Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MIF |
Rabbit polyclonal anti-macrophage migration inhibitory factor (MIF) antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 67 of human MIF |
Goat Polyclonal Antibody against MIF
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-NAANVGWNNSTFA, from the C Terminus of the protein sequence according to NP_002406.1. |
Chicken polyclonal anti-MIF antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This IgY fraction antibody was prepared from eggs of chickens laid after repeated immunizations with a synthetic peptide corresponding to aa 2-32 of Human MIF conjugated to keyhole limpet hemocyanin (KLH). MIF is a proinflammatory cytokine that plays an important role in systemic inflammatory events. |
Rabbit Polyclonal Anti-MIF Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MIF antibody: synthetic peptide directed towards the middle region of human MIF. Synthetic peptide located within the following region: PQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLL |