Germany
Japan
United Kingdom
China
Rabbit anti-PSME2 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PSME2 |
Primary Antibodies
View as table Download
Goat Polyclonal Antibody against PSME2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NLEKIVNPKGEEKP, from the C Terminus of the protein sequence according to NP_002809.2. |
Rabbit polyclonal Anti-PSME2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSME2 antibody: synthetic peptide directed towards the middle region of human PSME2. Synthetic peptide located within the following region: QEKVLERVNAVKTKVEAFQTTISKYFSERGDAVAKASKETHVMDYRALVH |
Rabbit polyclonal Anti-PSME2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSME2 antibody: synthetic peptide directed towards the middle region of human PSME2. Synthetic peptide located within the following region: SKETHVMDYRALVHERDEAAYGELRAMVLDLRAFYAELYHIISSNLEKIV |
Active filters
Target Symbol
- PSME2
Conjugates
- Unconjugated
Pathways
- Proteasome