Primary Antibodies

View as table Download

Rabbit polyclonal anti-RPS21 antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPS21.

Rabbit polyclonal RPS21 Antibody (C-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This RPS21 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 44-71 amino acids from the C-terminal region of human RPS21.

Rabbit Polyclonal Anti-RPS21 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RPS21 Antibody: synthetic peptide directed towards the N terminal of human RPS21. Synthetic peptide located within the following region: MQNDAGEFVDLYVPRKCSASNRIIGAKDHASIQMNVAEVDKVTGRFNGQF

Rabbit Polyclonal Anti-RPS21 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RPS21 Antibody: synthetic peptide directed towards the middle region of human RPS21. Synthetic peptide located within the following region: NVAEVDKVTGRFNGQFKTYAICGAIRRMGESDDSILRLAKADGIVSKNF