Primary Antibodies

Jump to Filters
View as table Download
ACSM2A Rabbit Polyclonal Antibody
TA332273

USD 375.00

5 Days

Rabbit Polyclonal Anti-ACSM2A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACSM2A Antibody is: synthetic peptide directed towards the C-terminal region of Human ACSM2A. Synthetic peptide located within the following region: SYKFPHLQNCVTVGESLLPETLENWRAQTGLDIRESYGQTETGLTCMVSK
ACSM2A Rabbit Polyclonal Antibody
TA356570

USD 360.00

5 Days

ACSM2A Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ACSM2A