Primary Antibodies

Jump to Filters
View as table Download
WHSC1 Rabbit Polyclonal Antibody
TA333862

USD 375.00

5 Days

Rabbit Polyclonal Anti-WHSC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-WHSC1 Antibody: synthetic peptide directed towards the N terminal of human WHSC1. Synthetic peptide located within the following region: KYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFG