Rabbit Polyclonal Anti-FSCN1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FSCN1 |
Rabbit Polyclonal Anti-FSCN1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FSCN1 |
Rabbit Polyclonal Anti-FSCN1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FSCN1 |
Rabbit polyclonal antibody to Fascin (fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus))
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 162 and 386 of Fascin 1 (Uniprot ID#Q16658) |
Rabbit Polyclonal Anti-Fscn1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Fscn1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VVAHDDGRWSLQSEAHRRYFGGTEDRLSCFAQSVSPAEKWSVHIAMHPQV |
Carrier-free (BSA/glycerol-free) FSCN1 mouse monoclonal antibody, clone OTI3B4 (formerly 3B4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FSCN1 mouse monoclonal antibody,clone OTI2C3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FSCN1 mouse monoclonal antibody,clone OTI3D2
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FSCN1 mouse monoclonal antibody, clone OTI5G1 (formerly 5G1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Fascin/FSCN1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 260-380 of human Fascin/Fascin/FSCN1 (NP_003079.1). |
Modifications | Unmodified |
Fascin/FSCN1 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 394-493 of human Fascin/Fascin/FSCN1 (NP_003079.1). |
Modifications | Unmodified |
Fascin Rabbit polyclonal Antibody
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human Fascin |
Fascin Rabbit polyclonal Antibody
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human Fascin |
FSCN1 mouse monoclonal antibody, clone OTI3B4 (formerly 3B4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
FSCN1 mouse monoclonal antibody, clone OTI3B4 (formerly 3B4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
FSCN1 mouse monoclonal antibody,clone OTI2C3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
FSCN1 mouse monoclonal antibody,clone OTI2C3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
FSCN1 mouse monoclonal antibody,clone OTI3D2
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
FSCN1 mouse monoclonal antibody,clone OTI3D2
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
FSCN1 mouse monoclonal antibody, clone OTI5G1 (formerly 5G1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
FSCN1 mouse monoclonal antibody, clone OTI5G1 (formerly 5G1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |