LOC100911951 mouse monoclonal antibody, clone K60/73
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
LOC100911951 mouse monoclonal antibody, clone K60/73
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
LOC100911951 mouse monoclonal antibody, clone K60/73
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-KCNIP2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNIP2 antibody: synthetic peptide directed towards the N terminal of human KCNIP2. Synthetic peptide located within the following region: QLTDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNPGALS |
Rabbit Polyclonal Anti-KCNIP2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNIP2 antibody: synthetic peptide directed towards the N terminal of human KCNIP2. Synthetic peptide located within the following region: PEGLEQLQEQTKFTRKELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQG |
Carrier-free (BSA/glycerol-free) KCNIP2 mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KCNIP2 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KCNIP2 mouse monoclonal antibody, clone OTI2G8 (formerly 2G8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KCNIP2 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KCNIP2 mouse monoclonal antibody, clone OTI10H1 (formerly 10H1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KCNIP2 mouse monoclonal antibody, clone OTI14A7 (formerly 14A7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KCNIP2 mouse monoclonal antibody, clone OTI10F10 (formerly 10F10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
KCNIP2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human KCNIP2 (NP_775284.1). |
Modifications | Unmodified |
KCNIP2 mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
KCNIP2 mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
KCNIP2 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
KCNIP2 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
KCNIP2 mouse monoclonal antibody, clone OTI2G8 (formerly 2G8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
KCNIP2 mouse monoclonal antibody, clone OTI2G8 (formerly 2G8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
KCNIP2 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
KCNIP2 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
KCNIP2 mouse monoclonal antibody, clone OTI10H1 (formerly 10H1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
KCNIP2 mouse monoclonal antibody, clone OTI10H1 (formerly 10H1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
KCNIP2 mouse monoclonal antibody, clone OTI14A7 (formerly 14A7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
KCNIP2 mouse monoclonal antibody, clone OTI14A7 (formerly 14A7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
KCNIP2 mouse monoclonal antibody, clone OTI10F10 (formerly 10F10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
KCNIP2 mouse monoclonal antibody, clone OTI10F10 (formerly 10F10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |