Rabbit polyclonal antibody to Tim17 (translocase of inner mitochondrial membrane 17 homolog A (yeast))
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 108 and 171 of TIM17 (Uniprot ID#Q99595) |
Rabbit Polyclonal Anti-Timm17a Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Timm17a antibody is: synthetic peptide directed towards the N-terminal region of Rat Timm17a. Synthetic peptide located within the following region: DCGGAFTMGTIGGGIFQAFKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGS |
TIMM17A rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Germany
Japan
United Kingdom
China
