Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-Cpa3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Cpa3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ILIHDLQEEIEKQFDVKDEIAGRHSYAKYNDWDKIVSWTEKMLEKHPEMV

CPA3 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 110-417 of human CPA3 (NP_001861.2).
Modifications Unmodified