Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-FCER1G Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FCER1G antibody: synthetic peptide directed towards the N terminal of human FCER1G. Synthetic peptide located within the following region: MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQV

FCER1G Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 19-86 of human FCER1G (NP_004097.1).
Modifications Unmodified

Recombinant Anti-Fc epsilon R (Clone IB10)

Applications FC
Reactivities Human
Conjugation Unconjugated

Recombinant Anti-Fc epsilon R (Clone IB10)

Applications FC
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques.

Recombinant Anti-Fc epsilon R (Clone IE7)

Applications FC
Reactivities Human
Conjugation Unconjugated

Recombinant Anti-Fc epsilon R (Clone IE7)

Applications FC
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques.