Rabbit monoclonal anti-NNMT antibody for SISCAPA, clone OTIR1F6
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit monoclonal anti-NNMT antibody for SISCAPA, clone OTIR1F6
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-NNMT Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NNMT antibody: synthetic peptide directed towards the N terminal of human NNMT. Synthetic peptide located within the following region: MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC |
NNMT rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NNMT |
Rabbit Polyclonal Antibody against NNMT (Center)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This NNMT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 77-106 amino acids from the Central region of human NNMT. |
Goat Anti-NNMT Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence TSKDTYLSHFNP-C, from the N Terminus of the protein sequence according to NP_006160.1. |
Goat Anti-NNMT (aa171-182) Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence PDLPTYCRALRN, from the internal region of the protein sequence according to NP_006160.1. |
Carrier-free (BSA/glycerol-free) NNMT mouse monoclonal antibody, clone OTI1A1 (formerly 1A1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NNMT mouse monoclonal antibody, clone OTI3E3 (formerly 3E3)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NNMT mouse monoclonal antibody, clone OTI2G8 (formerly 2G8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NNMT mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NNMT mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NNMT rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NNMT |
NNMT Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-264 of human NNMT (NP_006160.1). |
Modifications | Unmodified |
NNMT Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-264 of human NNMT (NP_006160.1). |
Modifications | Unmodified |
NNMT Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-264 of human NNMT (NP_006160.1). |
Modifications | Unmodified |
NNMT mouse monoclonal antibody, clone OTI1A1 (formerly 1A1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
NNMT mouse monoclonal antibody, clone OTI1A1 (formerly 1A1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
NNMT mouse monoclonal antibody, clone OTI3E3 (formerly 3E3)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NNMT mouse monoclonal antibody, clone OTI3E3 (formerly 3E3)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NNMT mouse monoclonal antibody, clone OTI2G8 (formerly 2G8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NNMT mouse monoclonal antibody, clone OTI2G8 (formerly 2G8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NNMT mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NNMT mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NNMT mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NNMT mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |