Primary Antibodies

View as table Download

Rabbit polyclonal anti-OR10J5 antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR10J5.

Rabbit polyclonal anti-OR6B2 antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR6B2.

Rabbit Polyclonal Anti-OR10J5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR10J5 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR10J5. Synthetic peptide located within the following region: CIDTTINEIINYGVSSFVIFVPIGLIFISYVLVISSILQIASAEGRKKTF

Rabbit Polyclonal Anti-OR10J5 Antibody (Extracellular Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen OR10J5 antibody was raised against synthetic 16 amino acid peptide from 2nd extracellular domain of human OR10J5. Percent identity with other species by BLAST analysis: Human, Gibbon, Elephant, Horse (100%); Gorilla, Hamster, Dog (94%); Mouse, Rat, Panda (88%); Bovine, Pig (81%).