Rabbit anti-PSMA2 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PSMA2 |
Rabbit anti-PSMA2 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PSMA2 |
Rabbit Polyclonal antibody to Proteasome 20S alpha 2 (proteasome (prosome, macropain) subunit, alpha type, 2)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 234 of Proteasome 20S alpha 2 (Uniprot ID#P25787) |
Rabbit polyclonal Anti-PSMA2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PSMA2 antibody: synthetic peptide directed towards the N terminal of human PSMA2. Synthetic peptide located within the following region: VGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRV |
Carrier-free (BSA/glycerol-free) PSMA2 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PSMA2 mouse monoclonal antibody, clone OTI4D12 (formerly 4D12)
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PSMA2 mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PSMA2 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PSMA2 mouse monoclonal antibody, clone OTI3E2 (formerly 3E2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PSMA2 mouse monoclonal antibody, clone OTI3H8 (formerly 3H8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PSMA2 mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Psma2 Antibody - C-terminal region
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Psma2 |
PSMA2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-234 of human PSMA2 (NP_002778.1). |
Modifications | Unmodified |
Proteasome alpha 2 Rabbit monoclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PSMA2 (Proteasome 20S alpha 2) mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PSMA2 (Proteasome 20S alpha 2) mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PSMA2 (Proteasome 20S alpha 2) mouse monoclonal antibody, clone OTI4D12 (formerly 4D12)
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
PSMA2 (Proteasome 20S alpha 2) mouse monoclonal antibody, clone OTI4D12 (formerly 4D12)
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
PSMA2 (Proteasome 20S alpha 2) mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
PSMA2 (Proteasome 20S alpha 2) mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
PSMA2 (Proteasome 20S alpha 2) mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PSMA2 (Proteasome 20S alpha 2) mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PSMA2 (Proteasome 20S alpha 2) mouse monoclonal antibody, clone OTI3E2 (formerly 3E2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PSMA2 (Proteasome 20S alpha 2) mouse monoclonal antibody, clone OTI3E2 (formerly 3E2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PSMA2 (Proteasome 20S alpha 2) mouse monoclonal antibody, clone OTI3H8 (formerly 3H8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PSMA2 (Proteasome 20S alpha 2) mouse monoclonal antibody, clone OTI3H8 (formerly 3H8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PSMA2 (Proteasome 20S alpha 2) mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
PSMA2 (Proteasome 20S alpha 2) mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |