Primary Antibodies

View as table Download

Rabbit Polyclonal TINAG Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal Anti-TINAG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TINAG antibody: synthetic peptide directed towards the middle region of human TINAG. Synthetic peptide located within the following region: VAADRIAIQSKGRYTANLSPQNLISCCAKNRHGCNSGSIDRAWWYLRKRG